PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_13025A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MIKC_MADS
Protein Properties Length: 270aa    MW: 30155 Da    PI: 9.1828
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_13025AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF91.83.4e-29958150
                               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
                     SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                               krien++ rqvtf+kRrng+lKKA+ELS+LCdae+a+iifs +g+lyey+
  Oropetium_20150105_13025A  9 KRIENTTSRQVTFCKRRNGLLKKAYELSILCDAEIALIIFSGRGRLYEYA 58
                               79***********************************************8 PP

2K-box111.87e-37831749100
                      K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenk 92 
                                 + + +++ qqe+akL+++i++Lq+++Rhl+Ge++++++ keL++Le++Le+++ +iRskK+ell+++ie++qk+e +lq+en 
  Oropetium_20150105_13025A  83 IDVNSHQYFQQEAAKLRQQIQTLQNSNRHLMGESIGNMTAKELKNLESRLERGIGRIRSKKHELLFTEIEYMQKREADLQNENI 166
                                566889****************************************************************************** PP

                      K-box  93 aLrkklee 100
                                +Lr+k++e
  Oropetium_20150105_13025A 167 YLRAKVAE 174
                                *****986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.193161IPR002100Transcription factor, MADS-box
SMARTSM004321.3E-40160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.96E-31274IPR002100Transcription factor, MADS-box
CDDcd002652.14E-45275No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-31323IPR002100Transcription factor, MADS-box
PfamPF003191.5E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-313859IPR002100Transcription factor, MADS-box
PfamPF014863.0E-2985172IPR002487Transcription factor, K-box
PROSITE profilePS5129715.37388178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0048440Biological Processcarpel development
GO:0048443Biological Processstamen development
GO:0048497Biological Processmaintenance of floral organ identity
GO:0090376Biological Processseed trichome differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MGRGKIEIKR IENTTSRQVT FCKRRNGLLK KAYELSILCD AEIALIIFSG RGRLYEYANN  60
SIRSTIERYK KASASTSGSA PVIDVNSHQY FQQEAAKLRQ QIQTLQNSNR HLMGESIGNM  120
TAKELKNLES RLERGIGRIR SKKHELLFTE IEYMQKREAD LQNENIYLRA KVAEADRAQQ  180
QVAAAEDHEM VPTSDGAMTT ELQALPASFD PRGYYQQQVS MLSHAASSSQ QYSEHHPGGP  240
EHHQTALHLG YHIKVDDPAA TAAAGKGIL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-20173173Myocyte-specific enhancer factor 2B
1tqe_Q2e-20173173Myocyte-specific enhancer factor 2B
1tqe_R2e-20173173Myocyte-specific enhancer factor 2B
1tqe_S2e-20173173Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00609ChIP-seqTransfer from AT4G18960Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970830.11e-145PREDICTED: MADS-box transcription factor 21
RefseqXP_004970831.11e-145PREDICTED: MADS-box transcription factor 21
SwissprotQ8RU311e-133MAD21_ORYSJ; MADS-box transcription factor 21
TrEMBLX2F5C71e-147X2F5C7_9POAL; MADS-box protein 21
STRINGSi002551m1e-145(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.12e-96MIKC_MADS family protein